PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004789G0060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 331aa    MW: 34990.2 Da    PI: 6.5109
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004789G0060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.57.5e-18207241135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  PH01004789G0060 207 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 241
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577163.04E-15200263No hitNo description
PROSITE profilePS5011412.453201237IPR000679Zinc finger, GATA-type
SMARTSM004013.3E-17201251IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-14204239IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.87E-15206257No hitNo description
PROSITE patternPS003440207232IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15207241IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEETAEYNVH GYYGGDKKGA ASGDHFVVDD LLVLPYDDEE EGEGEAGPSP EEEYDQLAEL  60
EWLSNYMGEG VDALASEDLQ KLQLISGIPS GGFSSSSVPP APAAPAAAVA SAMQPGIFHP  120
EGPVPAKARS KRSRAAPGNW SSRLLVLPPP PASPPSPVSM AISPAESGVS AQAFPVKKPS  180
KPAKKKDAPP QAHPSGGSAA AGEGRRCLHC ETDKTPQWRT GPMGPKTLCN ACGVRYKSGR  240
LVQEYRPAAS PTFMVSKHSN SHRKVLELRR QKEMQQQSAQ HQPHEAAGGV GSLMHIPSSL  300
LFDGPSASPI VGGDDFLIHH RLGTDFRQLI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644696.11e-130PREDICTED: GATA transcription factor 12
SwissprotP697813e-68GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A0D9V5J81e-145A0A0D9V5J8_9ORYZ; Uncharacterized protein
STRINGMLOC_58725.11e-130(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.17e-52GATA transcription factor 12